Archive for the ‘Community’ Category

Belief in Friday the 13th as Evil is a Sin

Saturday, April 14th, 2007

Yesterday was Friday the 13th. Now I’m going to say a simple statement and I’m not going to talk about the past, and what is the cause for Friday the 13th being viewed as bad luck. Belief in Friday the 13 as a day of bad luck and evil day is a sin.

6I am the LORD your G*d, who brought you out of the land of Egypt, out of the house of slavery;7you shall have no other gods before me.8You shall not make for yourself an idol, whether in the form of anything that is in heaven above, or that is on the earth beneath, or that is in the water under the earth.9You shall not bow down to them or worship them; for I the Lord your G*d am a jealous G*d, punishing children for the iniquity of parents, to the third and fourth generation of those who reject me, 10but showing steadfast love to the thousandth generation of those who love me and keep my commandments. ~ Deuteronomy 5:6-21

I’ve said this time and time again, belief any any superstition or idol, is a sin in the Jewish, Christian, and Islamic faith. Belief that any superstition beyond the grasp of G*d is a sin. And that’s all there is to it, end of story.

Ridgeway Chainsaw Carving Rendezvous (Part 4 of 4)

Saturday, March 24th, 2007

In case you have still no idea what this event is, I’ll give your the brief history. The Ridgway Chainsaw Carvers Rendezvous started as a gathering of six chainsaw carvers. Since then, the event has grown to be the world’s largest chainsaw carving event.

It is an open invitation to all Chainsaw Carvers. The event is an opportunity for all types of chainsaw carvers to share, market, learn, and teach. For carvers who tend to be leaned away from compositions, this is a great place to go to, as is not a competition but merely a gathering.

The Ridgway Rendezvous is a great event, I know every time I go I learn something new. If you’re a carver I suggest you go. I’ve gone there for four years. My first year, when I was a freshman at Notre Dame High School, I sold my first carving, a Tiki god, Having started carving a month or so before. I can say that much of my style of carving now was greatly influenced by what I have seen at Ridgway.

Having said all that i would like to thank all those who put the event together particularly the Boni’s and also the whole town of Ridgway who comes and takes part of the event.

Folding@Home

Friday, March 16th, 2007

Folding@home has been or will be implemented to help studies involving Alzheimer’s Disease, Cancer, Huntington’s Disease, Osteogenesis Imperfecta, Parkinson’s Disease, Ribosome & antibiotics. You can help buy simply installing Folding@Home on your computer. Folding@Home is a distributed computing project, meaning people across the globe are connecting their computers to fold virtual protein quicker than any supercomputer in the world could do.

Also for those who own a Sony Grill PS3, Folding@Home will be accessible within the Network menu of the XrossMediaBar. Now all the unused computing power can join the cause; maybe you can feel better now that you’re gaming machine you bought for $600 can now use it’s spare horsepower by going to help someone other than yourself.

So come on, it’s real easy to install, it’s available in all prevalent languages and in virtually all computing platforms. The program runs in the background or if you want you can look at the protein unfolding yourself. The program uses unused processes of your computer, meaning it won’t slow your computer down. For those of you who use your computer to only chat on AIM and leave your computer on all day long, install the program and let all that time your computer is doing nothing actually be productive by helping someone

Ridgeway Chainsaw Carving Rendezvous (3 of 4)

Sunday, March 11th, 2007

Before I came to the event, I thought the money was going to the Make A Wish Foundation, but I found out after, I carved and turned in my piece, that was not the case. I was a little mad, but I found out that the make a wish foundation was complaining about the way the event saw ran so the people who ran the event decided to find another charity. So now I’m not mad, as long as it’s going to a good cause.

So anyways the entire event and was dedicated in Honore of Bill Plant, a carver who died in the past year. He was given a “lifetime achievement award”, his grandson accepted the award. Every year now a new carver will be given this award, in dedication to him.

rcr_lifetimeaward

The award given to
Bill plants Grandson.

Ridgeway Chainsaw Carving Rendezvous (2 of 4)

Saturday, March 3rd, 2007

My dad made 2 blue Chickens herons for his donation. After that he made a fisherman and two eagles chickens.

Emil, my dad’s partner, caved two chickens owls, the first one he carved was intended to go as the piece for his donation, but before he finished it someone bought it off of him, so he made another one and submitted that one as his donation. After that he made banana split bench for a local ice-cream shop, called Two Scoops; a year early he had caved an ice-cream cone for the shop. The two cavings now sit in front of the shop.

I caved a Tiki, spending 2-6 hours a day, for about for days and made some minor burning changes the day before the auction. After that I carved 4 pine trees, 3 really quick and simple pigs bears, and a log cabin.

Images:

beforefinishedridgwaymytikiridgwaybananabench2hdadscarvingridgwat2007


Ridgeway Chainsaw Carving Rendezvous (1 of 4)

Monday, February 26th, 2007

Mysetupridgwaycarving_mouse_cheese

I just got back from my 9 day, winter break, trip at Ridgeway, Pennsylvania. My dad, His partner (Emil Szkipala), his son and I left on Friday. We started by checking into the Royal Inn. There were 227 registered carvers who showed up at the event. The auction took place 8 days later, bringing in 53,000 dollars. For those who don’t know, probably most of you, this event is a gathering and not a competition, it’s a great place to learn and grow when it comes to chainsaw carving. Unlike chainsaw carving competitions, this type of gathering allows carvers to be more relaxed and be more focused on having fun and not worried about your piece so much.

With 227 people carving, this is the largest event of its kind to ever take place. Carvers from all over the world came, most noticeable were the Germans who were flown for free this year. But carvers from Japan, Italy, Canada, Scotland, England and Australia were present. As I said this takes place in Ridgeway. This town is very small and seams like its deep in the mountains. The event took place, unlike last year at helicopter landing/fire department lot, at a factory’s parking lot that closed down a few years ago.

Anyways this event is huge and it will take a huge amount of post to cover, so I’ll explain more about the event throughout the next week or two.